PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.F02024.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 250aa    MW: 26989.3 Da    PI: 7.5941
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.F02024.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB181.38.3e-57108204197
             NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                       vreqdrflPian++rimkk+lPan+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfe+y++plk+yl++yrel
  Migut.F02024.1.p 108 VREQDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEEYIAPLKAYLARYREL 200
                       69******************************************************************************************* PP

             NF-YB  94 egek 97 
                       eg++
  Migut.F02024.1.p 201 EGDT 204
                       **97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.5E-54103222IPR009072Histone-fold
SuperFamilySSF471131.2E-39111222IPR009072Histone-fold
PfamPF008082.0E-28114178IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-19142160No hitNo description
PROSITE patternPS006850145161IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.4E-19161179No hitNo description
PRINTSPR006151.4E-19180198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MHNKLLDKAT EVVINKSLLP HLSVVRSPLS LPSDFSKFIS QSSLFFLSLP LRAKYKSTPH  60
PPRVLFFTSC EEETMADSPG GYGAGGGSGS HDNGGDGGGG DQSPRSGVRE QDRFLPIANI  120
GRIMKKALPA NGKIAKDAKD TVQECVSEFI SFVTSEASDK CQKEKRKTIN GDDLLWAMAT  180
LGFEEYIAPL KAYLARYREL EGDTKGSVRG AEGSGKKETA GTQLHSDPQF AHQGSFSQGF  240
SYSNSQIEY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A9e-45109199494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B9e-45109199494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012834698.11e-127PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2
SwissprotQ67XJ22e-74NFYBA_ARATH; Nuclear transcription factor Y subunit B-10
TrEMBLA0A022RGP31e-127A0A022RGP3_ERYGU; Uncharacterized protein
STRINGVIT_13s0019g03600.t014e-81(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.12e-73nuclear factor Y, subunit B10